PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10026610m
Common NameCARUB_v10026610mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GRF
Protein Properties Length: 374aa    MW: 41230.3 Da    PI: 8.1334
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10026610mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC71.97.4e-23115158245
              WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                       epgrCrRtDGKkWRC ++v++ +k+CErHlhrgr rsrk++e+
  Carubv10026610m 115 LEPGRCRRTDGKKWRCAKEVVSHHKYCERHLHRGRPRSRKHVEP 158
                      69***************************************996 PP

2QLQ52.71.3e-186697233
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlq 33
                     +FT+aQl +L++Q+++yKy++a++PvP +Ll+
  Carubv10026610m 66 PFTNAQLKELERQAMIYKYMIASVPVPFDLLV 97
                     9*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.4E-1165101IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.58566101IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.4E-116696IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.077114158IPR014977WRC domain
PfamPF088792.6E-18116157IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MDFLKVSDKT TIPCRSSDSM FGLNQQQYKD SSFGFRDMEI HPHPHGPHLI PPYSGNGVLG  60
CYYYYPFTNA QLKELERQAM IYKYMIASVP VPFDLLVSSS SSASPCNNKN MAGDLEPGRC  120
RRTDGKKWRC AKEVVSHHKY CERHLHRGRP RSRKHVEPPY SRPNNNGASV KNRDLKNIPK  180
KLASSSVKEK ILEPMEVSPS LSNYRESRGS EMFPVSATTD QENKYLNFID VWSDGVRSSE  240
KQSTTTSTPV SSSNANLSLY SLDLSMGGNN LMGQDEMGLI QMGLGVIGSD REDHHHGYGP  300
YGVASSLEEM SSWLAPMSTT PGGPLAEILR PSPNLAISGD IESYSLTATP SSSPSRVVKK  360
TMTSSVSDES SQI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006280651.10.0hypothetical protein CARUB_v10026610mg
SwissprotQ9FJB80.0GRF7_ARATH; Growth-regulating factor 7
TrEMBLR0GAD30.0R0GAD3_9BRAS; Uncharacterized protein
STRINGscaffold_801857.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM121062731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.10.0growth-regulating factor 7